Protease Inhibitors and Phosphatase Inhibitors
MilliporeSigma™ Calbiochem™ InSolution™ KN-92
Negative Control
MilliporeSigma™ Calbiochem™ PCSK9 Inhibitor, EGF-A
A 42-mer synthetic peptide (GTNECLDNNGGCSHVCNDLKIGYECLCPDGFQLVAQRRCEDI-NH2) that contains a calcium binding site of EGF-A
MilliporeSigma™ Calbiochem™ p53-Snail binding Inhibitor, GN25
The p53-Snail binding Inhibitor, GN25 controls the biological activity of p53-Snail. This small molecule/inhibitor is primarily used for Neuroscience applications.
MilliporeSigma™ Calbiochem™ UCN-01
A cell-permeable Staurosporine derived anticancer agent that reversibly and ATP-competitively inhibits several protein kinases.
MilliporeSigma™ Calbiochem™ (±)-Blebbistatin
(±)-Blebbistatin, CAS 674289-55-5, is a cell-permeable, selective, and reversible inhibitor of nonmuscle myosin II. Blocks cell blebbing and disrupts cell migration & cytoKinesis in vertebrate cells.
MilliporeSigma™ Calbiochem™ Cathepsin B Substrate III, Fluorogenic
Sensitive fluorogenic substrate for the quantitative determination of cathepsin B activity.
MilliporeSigma™ Calbiochem™ α-Synuclein Blocker, ELN484228
A cell-permeable compound that reversibly binds to pocket I of the monomeric α-synuclein (α-syn) and reverses α-syn-induced impairment of phagocytosis in H4 neuroglioma cells.
MilliporeSigma™ Calbiochem™ Mycophenolic Acid
An immunosuppressive agent that inhibits de novo purine nucleotide synthesis via inhibition of inosine monophosphate dehydrogenase and prevents the formation of XMP and GMP.
MilliporeSigma™ Calbiochem™ IRE1 Inhibitor IV, KIRA6
KIRA6, IRE1a Kinase Inhibitor.
MilliporeSigma™ Calbiochem™ Porcn Inhibitor IV, LGK974
A cell-permeable inhibitor of Wnt secretion from L-cell Wnt1/2/3/3a/6/7a/9a transfectants (IC50 from 50 pM to 1.1 nM).
MilliporeSigma™ Calbiochem™ Prodigiosin Serratia marcescens
A cell-permeable tripyrrole alkaloid compound that displays immunosuppressive and anti-tumor properties irrespective of p53 status and multidrug resistance.
MilliporeSigma™ Calbiochem™ K-252a, Nocardiopsis sp.
A cell-permeable, reversible, and ATP-competitive inhibitor against multiple protein kinases.
MilliporeSigma™ Calbiochem™ InSolution™ Latrunculin A, Latrunculia magnifica
A cell-permeable marine toxin from the Red Sea sponge Latrunculia magnifica that disrupts microfilament organization in cultured cells by the formation of a 1:1 complex with monomeric G-actin (Kd = 200nM)
MilliporeSigma™ Calbiochem™ InSolution™ Nutlin-3, Racemic
A cell-permeable, potent, and selective MDM2 antagonist (IC50 = 90nM for Nutlin-3a and 13
Novus Biologicals™ Celastrol, IL-17A (IL-17A Inhibitor)
Used in assays to inhibit IL-17A induction